TMEM35 antibody (C-Term)

Catalog No. ABIN635766

Product Details anti-TMEM35 Antibody

Target: TMEM35 (Transmembrane Protein 35 (TMEM35))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM35 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM35 antibody was raised against the C terminal of TMEM35

Purification: Affinity purified

Immunogen: TMEM35 antibody was raised using the C terminal of TMEM35 corresponding to a region with amino acids VFGILLTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM35 Blocking Peptide, catalog no. 33R-9525, is also available for use as a blocking control in assays to test for specificity of this TMEM35 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM35 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM35

Target: TMEM35 (Transmembrane Protein 35 (TMEM35))

Alternative Name: TMEM35 (TMEM35 Products)

Synonyms: Xp18 antibody, flj14084 antibody, wu:fc41e12 antibody, zgc:110832 antibody, 9030603L14Rik antibody, AI841526 antibody, PMP52 antibody, RSEP4 antibody, transmembrane protein 35A antibody, transmembrane protein 35 antibody, TMEM35A antibody, tmem35 antibody, tmem35a antibody, Tmem35 antibody, TMEM35 antibody, Tmem35a antibody

Background: TMEM35 is a multi-pass membrane protein. The exact function of TMEM35 remains unknown.

Molecular Weight: 18 kDa (MW of target protein)