ZP4 antibody (N-Term)

Catalog No. ABIN635764

Product Details anti-ZP4 Antibody

Target: ZP4 (Zona Pellucida Glycoprotein 4 (ZP4))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZP4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ZP4 antibody was raised against the N terminal of ZP4

Purification: Affinity purified

Immunogen: ZP4 antibody was raised using the N terminal of ZP4 corresponding to a region with amino acids MWLLRCVLLCVSLSLAVSGQHKPEAPDYSSVLHCGPWSFQFAVNLNQEAT

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZP4 Blocking Peptide, catalog no. 33R-6616, is also available for use as a blocking control in assays to test for specificity of this ZP4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZP4

Target: ZP4 (Zona Pellucida Glycoprotein 4 (ZP4))

Alternative Name: ZP4 (ZP4 Products)

Background: The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix.

Molecular Weight: 49 kDa (MW of target protein)