Tetraspanin 5 antibody (Middle Region)

Catalog No. ABIN635758

Product Details anti-Tetraspanin 5 Antibody

Target: Tetraspanin 5 (TSPAN5)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Tetraspanin 5 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: Tetraspanin 5 antibody was raised against the middle region of TSPAN5

Purification: Affinity purified

Immunogen: Tetraspanin 5 antibody was raised using the middle region of TSPAN5 corresponding to a region with amino acids ASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQ

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Tetraspanin 5 Blocking Peptide, catalog no. 33R-1526, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Tetraspanin 5

Target: Tetraspanin 5 (TSPAN5)

Alternative Name: Tetraspanin 5 (TSPAN5 Products)

Synonyms: net4 antibody, net-4 antibody, tm4sf9 antibody, tspan-5 antibody, MGC84872 antibody, tspan5 antibody, zgc:103404 antibody, MGC145322 antibody, NET-4 antibody, NET4 antibody, TM4SF9 antibody, TSPAN-5 antibody, 2810455A09Rik antibody, 4930505M03Rik antibody, AU024142 antibody, Tm4sf9 antibody, Tspan-5 antibody, tetraspanin 5 S homeolog antibody, tetraspanin 5 antibody, tetraspanin 5a antibody, tetraspanin-3 antibody, tetraspanin 5 L homeolog antibody, tspan5.S antibody, TSPAN5 antibody, tspan5a antibody, LOC725690 antibody, tspan5 antibody, tspan5.L antibody, Tspan5 antibody

Background: TSPAN5 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.

Molecular Weight: 30 kDa (MW of target protein)