PGAP3 antibody (N-Term)

Catalog No. ABIN635756

Product Details anti-PGAP3 Antibody

Target: PGAP3 (Post-GPI Attachment To Proteins 3 (PGAP3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PGAP3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PERLD1 antibody was raised against the N terminal of PERLD1

Purification: Affinity purified

Immunogen: PERLD1 antibody was raised using the N terminal of PERLD1 corresponding to a region with amino acids AGLAARLVLLAGAAALASGSQGDREPVYRDCVLQCEEQNCSGGALNHFRS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PERLD1 Blocking Peptide, catalog no. 33R-1204, is also available for use as a blocking control in assays to test for specificity of this PERLD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PERLD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PGAP3

Target: PGAP3 (Post-GPI Attachment To Proteins 3 (PGAP3))

Alternative Name: PERLD1 (PGAP3 Products)

Synonyms: GB10206 antibody, AGLA546 antibody, CAB2 antibody, PER1 antibody, PERLD1 antibody, PP1498 antibody, D430035D22Rik antibody, Perld1 antibody, perld1 antibody, pgap3 antibody, post-GPI attachment to proteins factor 3 antibody, post-GPI attachment to proteins 3 antibody, post-GPI attachment to proteins 3 L homeolog antibody, LOC412085 antibody, PGAP3 antibody, Pgap3 antibody, pgap3.L antibody, pgap3 antibody

Background: PERLD1 is involved in the lipid remodeling steps of GPI-anchor maturation. Lipid remodeling steps consist in the generation of 2 saturated fatty chains at the sn-2 position of GPI-anchors proteins.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Inositol Metabolic Process