FLT3LG antibody (N-Term)
-
- Target See all FLT3LG Antibodies
- FLT3LG (Fms-Related tyrosine Kinase 3 Ligand (FLT3LG))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FLT3LG antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Flt3 Ligand antibody was raised against the N terminal of FLT3 LG
- Purification
- Affinity purified
- Immunogen
- Flt3 Ligand antibody was raised using the N terminal of FLT3 LG corresponding to a region with amino acids TVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDY
- Top Product
- Discover our top product FLT3LG Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Flt3 Ligand Blocking Peptide, catalog no. 33R-9360, is also available for use as a blocking control in assays to test for specificity of this Flt3 Ligand antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLT0 G antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FLT3LG (Fms-Related tyrosine Kinase 3 Ligand (FLT3LG))
- Alternative Name
- Flt3 Ligand (FLT3LG Products)
- Background
- FLT3LG stimulates the proliferation of early hematopoietic cells and synergizes well with a number of other colony stimulating factors and interleukins.
- Molecular Weight
- 26 kDa (MW of target protein)
- Pathways
- RTK Signaling
-