LRRTM1 antibody (Middle Region)
-
- Target See all LRRTM1 Antibodies
- LRRTM1 (Leucine Rich Repeat Transmembrane Neuronal 1 (LRRTM1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LRRTM1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LRRTM1 antibody was raised against the middle region of LRRTM1
- Purification
- Affinity purified
- Immunogen
- LRRTM1 antibody was raised using the middle region of LRRTM1 corresponding to a region with amino acids CALASWLNNFQGRYDGNLQCASPEYAQGEDVLDAVYAFHLCEDGAEPTSG
- Top Product
- Discover our top product LRRTM1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LRRTM1 Blocking Peptide, catalog no. 33R-1644, is also available for use as a blocking control in assays to test for specificity of this LRRTM1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRTM1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LRRTM1 (Leucine Rich Repeat Transmembrane Neuronal 1 (LRRTM1))
- Alternative Name
- LRRTM1 (LRRTM1 Products)
- Synonyms
- im:6904481 antibody, 4632401D06Rik antibody, AW125451 antibody, leucine rich repeat transmembrane neuronal 1 antibody, lrrtm1 antibody, LRRTM1 antibody, Lrrtm1 antibody
- Background
- LRRTM1 may play a role during the development of specific forebrain structures by influencing neuronal differentiation and connectivity, with a possible role in intracellular trafficking within axons.
- Molecular Weight
- 59 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-