alpha-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 3 (SIA7C) (C-Term) antibody
-
- Target See all alpha-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 3 (SIA7C) Antibodies
- alpha-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 3 (SIA7C)
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ST6 GALNAC3 antibody was raised against the C terminal of ST6 ALNAC3
- Purification
- Affinity purified
- Immunogen
- ST6 GALNAC3 antibody was raised using the C terminal of ST6 ALNAC3 corresponding to a region with amino acids HYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHPNWT
- Top Product
- Discover our top product SIA7C Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ST6GALNAC3 Blocking Peptide, catalog no. 33R-3882, is also available for use as a blocking control in assays to test for specificity of this ST6GALNAC3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 ALNAC3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- alpha-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 3 (SIA7C)
- Alternative Name
- ST6GALNAC3 (SIA7C Products)
- Background
- ST6GALNAC3 belongs to a family of sialyltransferases that transfer sialic acids from CMP-sialic acid to terminal positions of carbohydrate groups in glycoproteins and glycolipids.
- Molecular Weight
- 35 kDa (MW of target protein)
-