alpha-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 3 (SIA7C) (C-Term) antibody

Catalog No. ABIN635748

Product Details

Target: alpha-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 3 (SIA7C)

Binding Specificity: C-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Specificity: ST6 GALNAC3 antibody was raised against the C terminal of ST6 ALNAC3

Purification: Affinity purified

Immunogen: ST6 GALNAC3 antibody was raised using the C terminal of ST6 ALNAC3 corresponding to a region with amino acids HYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHPNWT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ST6GALNAC3 Blocking Peptide, catalog no. 33R-3882, is also available for use as a blocking control in assays to test for specificity of this ST6GALNAC3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 ALNAC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: alpha-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 3 (SIA7C)

Alternative Name: ST6GALNAC3 (SIA7C Products)

Synonyms: fb68h09 antibody, siat7c antibody, st6GalNAc-III antibody, wu:fb67c12 antibody, wu:fb68h09 antibody, zgc:73301 antibody, SIAT7C antibody, PRO7177 antibody, ST6GALNACIII antibody, STY antibody, Siat7c antibody, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 antibody, ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 antibody, st6galnac3 antibody, ST6GALNAC3 antibody, St6galnac3 antibody

Background: ST6GALNAC3 belongs to a family of sialyltransferases that transfer sialic acids from CMP-sialic acid to terminal positions of carbohydrate groups in glycoproteins and glycolipids.

Molecular Weight: 35 kDa (MW of target protein)