LIM2 antibody (N-Term)
-
- Target See all LIM2 Antibodies
- LIM2 (Lens Intrinsic Membrane Protein 2, 19kDa (LIM2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LIM2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LIM2 antibody was raised against the N terminal of LIM2
- Purification
- Affinity purified
- Immunogen
- LIM2 antibody was raised using the N terminal of LIM2 corresponding to a region with amino acids GSFAHQGLWRYCLGNKCYLQTDSIGEPPGQGPGRAWGKSRADLGAQGHLY
- Top Product
- Discover our top product LIM2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LIM2 Blocking Peptide, catalog no. 33R-3559, is also available for use as a blocking control in assays to test for specificity of this LIM2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIM2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LIM2 (Lens Intrinsic Membrane Protein 2, 19kDa (LIM2))
- Alternative Name
- LIM2 (LIM2 Products)
- Synonyms
- 19kDa antibody, 4833403J20 antibody, MP19 antibody, To3 antibody, MP20 antibody, Mp19 antibody, CTRCT19 antibody, MP17 antibody, lens intrinsic membrane protein 2 antibody, Lim2 antibody, LIM2 antibody
- Background
- This gene encodes an eye lens-specific protein found at the junctions of lens fiber cells, where it may contribute to cell junctional organization.
- Molecular Weight
- 24 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-