XYLT2 antibody (Middle Region)
-
- Target See all XYLT2 Antibodies
- XYLT2 (Xylosyltransferase II (XYLT2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Mouse, Human, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This XYLT2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- XYLT2 antibody was raised against the middle region of XYLT2
- Purification
- Affinity purified
- Immunogen
- XYLT2 antibody was raised using the middle region of XYLT2 corresponding to a region with amino acids PMGTPLCRFEPRGLPSSVHLYFYDDHFQGYLVTQAVQPSAQGPAETLEMW
- Top Product
- Discover our top product XYLT2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
XYLT2 Blocking Peptide, catalog no. 33R-7222, is also available for use as a blocking control in assays to test for specificity of this XYLT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XYLT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- XYLT2 (Xylosyltransferase II (XYLT2))
- Alternative Name
- XYLT2 (XYLT2 Products)
- Background
- XYLT2 is an isoform of xylosyltransferase, which belongs to a family of glycosyltransferases.
- Molecular Weight
- 97 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-