PAM antibody (N-Term)

Catalog No. ABIN635741

Product Details anti-PAM Antibody

Target: PAM (Peptidylglycine alpha-Amidating Monooxygenase (PAM))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PAM antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PAM antibody was raised against the N terminal of PAM

Purification: Affinity purified

Immunogen: PAM antibody was raised using the N terminal of PAM corresponding to a region with amino acids PKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PAM Blocking Peptide, catalog no. 33R-7169, is also available for use as a blocking control in assays to test for specificity of this PAM antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PAM

Target: PAM (Peptidylglycine alpha-Amidating Monooxygenase (PAM))

Alternative Name: PAM (PAM Products)

Synonyms: PAL antibody, PHM antibody, pal antibody, phm antibody, pamb antibody, CG3832 antibody, Dmel\\CG3832 antibody, dPHM antibody, AE-I antibody, PAL-A antibody, PHM-A antibody, pama antibody, si:dkeyp-35f12.2 antibody, peptidylglycine alpha-amidating monooxygenase antibody, peptidylglycine alpha-amidating monooxygenase S homeolog antibody, Peptidylglycine-alpha-hydroxylating monooxygenase antibody, peptidylglycine alpha-amidating monooxygenase L homeolog antibody, PAM antibody, Pam antibody, pam.S antibody, CHLREDRAFT_150435 antibody, sce7070 antibody, pam antibody, Phm antibody, pam.L antibody

Background: PAM is a multifunctional protein. It has two enzymatically active domains with catalytic activities-peptidylglycine alpha-hydroxylating monooxygenase (PHM) and peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL). These catalytic domains work sequentially to catalyze neuroendocrine peptides to active alpha-amidated products.

Molecular Weight: 108 kDa (MW of target protein)