SLC35A5 antibody (N-Term)

Catalog No. ABIN635739

Product Details anti-SLC35A5 Antibody

Target: SLC35A5 (Solute Carrier Family 35, Member A5 (SLC35A5))

Binding Specificity: N-Term

Reactivity: Mouse, Rat, Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC35A5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC35 A5 antibody was raised against the N terminal of SLC35 5

Purification: Affinity purified

Immunogen: SLC35 A5 antibody was raised using the N terminal of SLC35 5 corresponding to a region with amino acids LVKYSANEENKYDYLPTTVNVCSELVKLVFCVLVSFCVIKKDHQSRNLKY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC35A5 Blocking Peptide, catalog no. 33R-5521, is also available for use as a blocking control in assays to test for specificity of this SLC35A5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC35A5

Target: SLC35A5 (Solute Carrier Family 35, Member A5 (SLC35A5))

Alternative Name: SLC35A5 (SLC35A5 Products)

Synonyms: DKFZp459B2411 antibody, si:bz20i5.1 antibody, zgc:66231 antibody, 1010001J06Rik antibody, AU021179 antibody, BB097433 antibody, D16Ertd450e antibody, D730043G07Rik antibody, RGD1564361 antibody, solute carrier family 35 member A5 antibody, solute carrier family 35, member A5 antibody, solute carrier family 35 member A5 S homeolog antibody, SLC35A5 antibody, slc35a5 antibody, slc35a5.S antibody, Slc35a5 antibody

Background: SLC35A5 belongs to the nucleotide-sugar transporter family, SLC35A subfamily. It is a multi-pass membrane protein. The function of the SLC35A5 protein remains unknown.

Molecular Weight: 48 kDa (MW of target protein)