GALC antibody (Middle Region)

Catalog No. ABIN635737

Product Details anti-GALC Antibody

Target: GALC (Galactosylceramidase (GALC))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GALC antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GALC antibody was raised against the middle region of GALC

Purification: Affinity purified

Immunogen: GALC antibody was raised using the middle region of GALC corresponding to a region with amino acids LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVAL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GALC Blocking Peptide, catalog no. 33R-5213, is also available for use as a blocking control in assays to test for specificity of this GALC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GALC

Target: GALC (Galactosylceramidase (GALC))

Alternative Name: GALC (GALC Products)

Synonyms: 2310068B06Rik antibody, A930008M05Rik antibody, AW212969 antibody, AW413532 antibody, Gacy antibody, twi antibody, twitcher antibody, galc antibody, galcl antibody, zgc:92561 antibody, si:ch211-199l3.4 antibody, GALCERase antibody, wu:fi04e07 antibody, zgc:56444 antibody, galactosylceramidase antibody, galactosylceramidase a antibody, Galactosylceramidase antibody, galactosylceramidase L homeolog antibody, galactosylceramidase b antibody, GALC antibody, Galc antibody, galca antibody, galc antibody, Caci_7107 antibody, Bacsa_1415 antibody, Spico_0384 antibody, LOC100304802 antibody, galc.L antibody, galcb antibody

Background: GALC is a lysosomal protein which hydrolyzes the galactose ester bonds of galactosylceramide, galactosylsphingosine, lactosylceramide, and monogalactosyldiglyceride. Mutations in this gene have been associated with Krabbe disease, also known as globoid cell leukodystrophy.

Molecular Weight: 73 kDa (MW of target protein)