NKAIN1 antibody (Middle Region)
-
- Target See all NKAIN1 Antibodies
- NKAIN1 (Na+/K+ Transporting ATPase Interacting 1 (NKAIN1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NKAIN1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NKAIN1 antibody was raised against the middle region of NKAIN1
- Purification
- Affinity purified
- Immunogen
- NKAIN1 antibody was raised using the middle region of NKAIN1 corresponding to a region with amino acids TPVLNSRLALEDHHVISVTGCLLDYPYIEALSSALQIFLALFGFVFACYV
- Top Product
- Discover our top product NKAIN1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NKAIN1 Blocking Peptide, catalog no. 33R-9236, is also available for use as a blocking control in assays to test for specificity of this NKAIN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NKAIN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NKAIN1 (Na+/K+ Transporting ATPase Interacting 1 (NKAIN1))
- Alternative Name
- NKAIN1 (NKAIN1 Products)
- Synonyms
- FAM77C antibody, 2610200G18Rik antibody, 2810426C15Rik antibody, RGD1561205 antibody, fam77c antibody, sodium/potassium transporting ATPase interacting 1 antibody, Na+/K+ transporting ATPase interacting 1 antibody, Sodium/potassium transporting ATPase interacting 1 antibody, Na+/K+ transporting ATPase interacting 1 L homeolog antibody, NKAIN1 antibody, Nkain1 antibody, nkain1.L antibody
- Background
- It belongs to the NKAIN family. The exact function of NKAIN1 remains unknown.
- Molecular Weight
- 18 kDa (MW of target protein)
-