ABCA12 antibody
-
- Target See all ABCA12 Antibodies
- ABCA12 (ATP-Binding Cassette, Sub-Family A (ABC1), Member 12 (ABCA12))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ABCA12 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ABCA12 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLV
- Top Product
- Discover our top product ABCA12 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ABCA12 Blocking Peptide, catalog no. 33R-9318, is also available for use as a blocking control in assays to test for specificity of this ABCA12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCA12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ABCA12 (ATP-Binding Cassette, Sub-Family A (ABC1), Member 12 (ABCA12))
- Alternative Name
- ABCA12 (ABCA12 Products)
- Background
- The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes.
- Molecular Weight
- 257 kDa (MW of target protein)
-