SLC37A1 antibody

Catalog No. ABIN635725

Product Details anti-SLC37A1 Antibody

Target: SLC37A1 (Solute Carrier Family 37 Member 1 (SLC37A1))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC37A1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SLC37 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKIPGVIEFSLCLLFAKLVSYTFLFWLPLYITNVDHLDAKKAGELSTLFD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC37A1 Blocking Peptide, catalog no. 33R-5087, is also available for use as a blocking control in assays to test for specificity of this SLC37A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC37A1

Target: SLC37A1 (Solute Carrier Family 37 Member 1 (SLC37A1))

Alternative Name: SLC37A1 (SLC37A1 Products)

Synonyms: MGC53019 antibody, G3PP antibody, zgc:101659 antibody, solute carrier family 37 (glucose-6-phosphate transporter), member 1 L homeolog antibody, solute carrier family 37 member 1 antibody, solute carrier family 37 (glucose-6-phosphate transporter), member 1 antibody, solute carrier family 37 (glycerol-3-phosphate transporter), member 1 antibody, slc37a1.L antibody, SLC37A1 antibody, Slc37a1 antibody, slc37a1 antibody

Background: SLC37A1, a member of the sugar-phosphate transport family, transports glycerol-3-phosphate (G3P) between cellular compartments for its utilization in several compartment-specific biochemical pathways.SLC37A1, a member of the sugar-phosphate transport family, transports glycerol-3-phosphate (G3P) between cellular compartments for its utilization in several compartment-specific biochemical pathways.

Molecular Weight: 58 kDa (MW of target protein)