Netrin 4 antibody (N-Term)

Catalog No. ABIN635714

Product Details anti-Netrin 4 Antibody

Target: Netrin 4 (NTN4)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Netrin 4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Netrin 4 antibody was raised against the N terminal of NTN4

Purification: Affinity purified

Immunogen: Netrin 4 antibody was raised using the N terminal of NTN4 corresponding to a region with amino acids EDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Netrin 4 Blocking Peptide, catalog no. 33R-2330, is also available for use as a blocking control in assays to test for specificity of this Netrin 4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NTN4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Netrin 4

Target: Netrin 4 (NTN4)

Alternative Name: Netrin 4 (NTN4 Products)

Synonyms: Netrin-4 antibody, PRO3091 antibody, RGD1565947 antibody, netrin 4 antibody, netrin-4 antibody, NTN4 antibody, ntn4 antibody, Ntn4 antibody, LOC100541214 antibody

Background: NTN4 contains 3 laminin EGF-like domains, 1 laminin N-terminal domain and 1 NTR domain. NTN4 may play an important role in neural, kidney and vascular development. It promotes neurite elongation from olfactory bulb explants.

Molecular Weight: 70 kDa (MW of target protein)