Netrin 4 antibody (N-Term)
-
- Target See all Netrin 4 (NTN4) Antibodies
- Netrin 4 (NTN4)
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Netrin 4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Netrin 4 antibody was raised against the N terminal of NTN4
- Purification
- Affinity purified
- Immunogen
- Netrin 4 antibody was raised using the N terminal of NTN4 corresponding to a region with amino acids EDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKY
- Top Product
- Discover our top product NTN4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Netrin 4 Blocking Peptide, catalog no. 33R-2330, is also available for use as a blocking control in assays to test for specificity of this Netrin 4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NTN4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Netrin 4 (NTN4)
- Alternative Name
- Netrin 4 (NTN4 Products)
- Synonyms
- Netrin-4 antibody, PRO3091 antibody, RGD1565947 antibody, netrin 4 antibody, netrin-4 antibody, NTN4 antibody, ntn4 antibody, Ntn4 antibody, LOC100541214 antibody
- Background
- NTN4 contains 3 laminin EGF-like domains, 1 laminin N-terminal domain and 1 NTR domain. NTN4 may play an important role in neural, kidney and vascular development. It promotes neurite elongation from olfactory bulb explants.
- Molecular Weight
- 70 kDa (MW of target protein)
-