NDST4 antibody
-
- Target See all NDST4 Antibodies
- NDST4 (N-Deacetylase/N-Sulfotransferase (Heparan Glucosaminyl) 4 (NDST4))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NDST4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- NDST4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDWTIFQYNHSTYQPVLLTELQTEKSLSSLSSKTLFATVIQDLGLHDGIQ
- Top Product
- Discover our top product NDST4 Primary Antibody
-
anti-N-Deacetylase/N-Sulfotransferase (Heparan Glucosaminyl) 4 (NDST4) (AA 1-872) antibody
NDST4 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
anti-N-Deacetylase/N-Sulfotransferase (Heparan Glucosaminyl) 4 (NDST4) (AA 185-212), (N-Term) antibodyNDST4 Reactivity: Human WB Host: Rabbit Polyclonal RB38312 unconjugated
anti-N-Deacetylase/N-Sulfotransferase (Heparan Glucosaminyl) 4 (NDST4) (AA 122-214) antibodyNDST4 Reactivity: Human WB, ELISA Host: Mouse Polyclonal unconjugated
anti-N-Deacetylase/N-Sulfotransferase (Heparan Glucosaminyl) 4 (NDST4) (AA 611-660) antibodyNDST4 Reactivity: Human, Mouse, Cow, Horse, Rabbit, Dog, Monkey WB Host: Rabbit Polyclonal unconjugated
anti-N-Deacetylase/N-Sulfotransferase (Heparan Glucosaminyl) 4 (NDST4) (AA 218-267) antibodyNDST4 Reactivity: Human, Mouse, Cow, Horse, Rabbit, Rat WB Host: Rabbit Polyclonal unconjugated
anti-N-Deacetylase/N-Sulfotransferase (Heparan Glucosaminyl) 4 (NDST4) (AA 1-872) antibodyNDST4 Reactivity: Human WB Host: Mouse Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NDST4 Blocking Peptide, catalog no. 33R-2334, is also available for use as a blocking control in assays to test for specificity of this NDST4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDST4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NDST4 (N-Deacetylase/N-Sulfotransferase (Heparan Glucosaminyl) 4 (NDST4))
- Alternative Name
- NDST4 (NDST4 Products)
- Synonyms
- NDST-4 antibody, NHSST4 antibody, 4930439H17Rik antibody, N-deacetylase and N-sulfotransferase 4 antibody, N-deacetylase/N-sulfotransferase (heparin glucosaminyl) 4 antibody, NDST4 antibody, Ndst4 antibody
- Background
- NDST4 is an essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. It modifies the GlcNAc-GlcA dissacharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. NDST4 has low deacetylase activity but high sulfotransferase activity.
- Molecular Weight
- 101 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-
