MTCH1 antibody

Catalog No. ABIN635711

Product Details anti-MTCH1 Antibody

Target: MTCH1 (Mitochondrial Carrier 1 (MTCH1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MTCH1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: MTCH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NNCGLQAGLPPYSPVFKSWIHCWKYLSVQGQLFRGSSLLFRRVSSGSCFA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MTCH1 Blocking Peptide, catalog no. 33R-6803, is also available for use as a blocking control in assays to test for specificity of this MTCH1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTCH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MTCH1

Target: MTCH1 (Mitochondrial Carrier 1 (MTCH1))

Alternative Name: MTCH1 (MTCH1 Products)

Synonyms: CGI-64 antibody, PIG60 antibody, PSAP antibody, SLC25A49 antibody, 2310034O17Rik antibody, AI255158 antibody, AU018396 antibody, C77849 antibody, MTCH1 antibody, mitochondrial carrier 1 antibody, MTCH1 antibody, Mtch1 antibody

Background: MTCH1 is a potential mitochondrial transporter. It may play a role in apoptosis.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity, SARS-CoV-2 Protein Interactome