ST8SIA2 antibody (C-Term)
-
- Target See all ST8SIA2 Antibodies
- ST8SIA2 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 2 (ST8SIA2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ST8SIA2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- ST8 SIA2 antibody was raised against the C terminal of ST8 IA2
- Purification
- Affinity purified
- Immunogen
- ST8 SIA2 antibody was raised using the C terminal of ST8 IA2 corresponding to a region with amino acids TGLLMYTLATRFCKQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQAS
- Top Product
- Discover our top product ST8SIA2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ST8SIA2 Blocking Peptide, catalog no. 33R-9089, is also available for use as a blocking control in assays to test for specificity of this ST8SIA2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 IA2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ST8SIA2 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 2 (ST8SIA2))
- Alternative Name
- ST8SIA2 (ST8SIA2 Products)
- Background
- ST8SIA2 is a type II membrane protein that is thought to catalyze the transfer of sialic acid from CMP-sialic acid to N-linked oligosaccharides and glycoproteins. ST8SIA2 may be found in the Golgi apparatus and may be involved in the production of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). This protein is a member of glycosyltransferase family 29.
- Molecular Weight
- 42 kDa (MW of target protein)
-