ST8SIA2 antibody (C-Term)

Catalog No. ABIN635706

Product Details anti-ST8SIA2 Antibody

Target: ST8SIA2 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 2 (ST8SIA2))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ST8SIA2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: ST8 SIA2 antibody was raised against the C terminal of ST8 IA2

Purification: Affinity purified

Immunogen: ST8 SIA2 antibody was raised using the C terminal of ST8 IA2 corresponding to a region with amino acids TGLLMYTLATRFCKQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQAS

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ST8SIA2 Blocking Peptide, catalog no. 33R-9089, is also available for use as a blocking control in assays to test for specificity of this ST8SIA2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 IA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ST8SIA2

Target: ST8SIA2 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 2 (ST8SIA2))

Alternative Name: ST8SIA2 (ST8SIA2 Products)

Synonyms: cb394 antibody, id:ibd5161 antibody, siat8 antibody, SIAT8B antibody, HsT19690 antibody, ST8SIA-II antibody, STX antibody, SIAT 8B antibody, AI323367 antibody, ST8SiaII antibody, Siat8b antibody, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2 antibody, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2 L homeolog antibody, st8sia2 antibody, st8sia2.L antibody, ST8SIA2 antibody, St8sia2 antibody

Background: ST8SIA2 is a type II membrane protein that is thought to catalyze the transfer of sialic acid from CMP-sialic acid to N-linked oligosaccharides and glycoproteins. ST8SIA2 may be found in the Golgi apparatus and may be involved in the production of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). This protein is a member of glycosyltransferase family 29.

Molecular Weight: 42 kDa (MW of target protein)