Sonic Hedgehog antibody

Catalog No. ABIN635696

Product Details anti-Sonic Hedgehog Antibody

Target: Sonic Hedgehog (SHH)

Reactivity: Human, Mouse, Zebrafish (Danio rerio), Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Sonic Hedgehog antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogen: Sonic Hedgehog antibody was raised using a synthetic peptide corresponding to a region with amino acids RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Sonic Hedgehog Blocking Peptide, catalog no. 33R-7837, is also available for use as a blocking control in assays to test for specificity of this Sonic Hedgehog antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Sonic Hedgehog

Target: Sonic Hedgehog (SHH)

Alternative Name: Sonic Hedgehog (SHH Products)

Synonyms: HHG1 antibody, HLP3 antibody, HPE3 antibody, MCOPCB5 antibody, SMMCI antibody, TPT antibody, TPTPS antibody, 9530036O11Rik antibody, Dsh antibody, Hhg1 antibody, Hx antibody, Hxl3 antibody, M100081 antibody, fc83d08 antibody, shh antibody, syu antibody, vhh-1 antibody, vhh1 antibody, wu:fc83d08 antibody, Xhh antibody, hedgehog antibody, xshh antibody, SHH antibody, twh antibody, twhh antibody, sonic hedgehog antibody, sonic hedgehog a antibody, sonic hedgehog L homeolog antibody, sonic hedgehog protein A antibody, sonic hedgehog b antibody, SHH antibody, Shh antibody, shha antibody, shh.L antibody, shh antibody, shhb antibody

Background: SHH is a protein that is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE). It is also thought that mutations in its gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: Hedgehog Signaling, Dopaminergic Neurogenesis, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development