NTRK3 antibody (C-Term)
-
- Target See all NTRK3 Antibodies
- NTRK3 (Neurotrophic tyrosine Kinase, Receptor, Type 3 (NTRK3))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NTRK3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NTRK3 antibody was raised against the C terminal of NTRK3
- Purification
- Affinity purified
- Immunogen
- NTRK3 antibody was raised using the C terminal of NTRK3 corresponding to a region with amino acids ERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG
- Top Product
- Discover our top product NTRK3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NTRK3 Blocking Peptide, catalog no. 33R-2709, is also available for use as a blocking control in assays to test for specificity of this NTRK3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NTRK3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NTRK3 (Neurotrophic tyrosine Kinase, Receptor, Type 3 (NTRK3))
- Alternative Name
- NTRK3 (NTRK3 Products)
- Synonyms
- TRKC antibody, gp145(trkC) antibody, trkC antibody, AW125844 antibody, Ntrk3_tv3 antibody, TrkC antibody, neurotrophic receptor tyrosine kinase 3 antibody, neurotrophic tyrosine kinase, receptor, type 3 antibody, NTRK3 antibody, Ntrk3 antibody
- Background
- NTRK3 is a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. Mutations in this gene have been associated with medulloblastomas, secretory breast carcinomas and other cancers.
- Molecular Weight
- 89 kDa (MW of target protein)
- Pathways
- RTK Signaling, Neurotrophin Signaling Pathway, Regulation of Cell Size
-