SMPD1 antibody (Middle Region)
-
- Target See all SMPD1 Antibodies
- SMPD1 (Sphingomyelin phosphodiesterase 1, Acid Lysosomal (SMPD1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SMPD1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SMPD1 antibody was raised against the middle region of SMPD1
- Purification
- Affinity purified
- Immunogen
- SMPD1 antibody was raised using the middle region of SMPD1 corresponding to a region with amino acids INSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV
- Top Product
- Discover our top product SMPD1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SMPD1 Blocking Peptide, catalog no. 33R-4082, is also available for use as a blocking control in assays to test for specificity of this SMPD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMPD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SMPD1 (Sphingomyelin phosphodiesterase 1, Acid Lysosomal (SMPD1))
- Alternative Name
- SMPD1 (SMPD1 Products)
- Synonyms
- ASM antibody, ASMASE antibody, NPD antibody, A-SMase antibody, Zn-SMase antibody, aSMase antibody, SMPD1 antibody, sphingomyelin phosphodiesterase 1 antibody, sphingomyelin phosphodiesterase 1, acid lysosomal antibody, sphingomyelin phosphodiesterase antibody, SMPD1 antibody, Smpd1 antibody, LOC5578088 antibody
- Background
- SMPD1 is a lysosomal acid sphingomyelinase that converts sphingomyelin to ceramide. The encoded protein also has phospholipase C activity. Defects in this gene are a cause of Niemann-Pick disease type A (NPA) and Niemann-Pick disease type B (NPB).
- Molecular Weight
- 65 kDa (MW of target protein)
-