ALDH3A2 antibody (C-Term)
-
- Target See all ALDH3A2 Antibodies
- ALDH3A2 (Aldehyde Dehydrogenase 3 Family, Member A2 (ALDH3A2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ALDH3A2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- ALDH3 A2 antibody was raised against the C terminal of ALDH3 2
- Purification
- Affinity purified
- Immunogen
- ALDH3 A2 antibody was raised using the C terminal of ALDH3 2 corresponding to a region with amino acids FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG
- Top Product
- Discover our top product ALDH3A2 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ALDH3A2 Blocking Peptide, catalog no. 33R-2933, is also available for use as a blocking control in assays to test for specificity of this ALDH3A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALDH3A2 (Aldehyde Dehydrogenase 3 Family, Member A2 (ALDH3A2))
- Alternative Name
- ALDH3A2 (ALDH3A2 Products)
- Background
- Aldehyde dehydrogenase isozymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. This gene product catalyzes the oxidation of long-chain aliphatic aldehydes to fatty acid. Mutations in the gene cause Sjogren-Larsson syndrome.
- Molecular Weight
- 53 kDa (MW of target protein)
-