LRCH4 antibody
-
- Target See all LRCH4 Antibodies
- LRCH4 (Leucine-Rich Repeats and Calponin Homology (CH) Domain Containing 4 (LRCH4))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LRCH4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- LRCH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEEAVATGTLNLSNRRLKHFPRGAARSYDLSDITQADLSRNRFPEVPEAA
- Top Product
- Discover our top product LRCH4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LRCH4 Blocking Peptide, catalog no. 33R-4887, is also available for use as a blocking control in assays to test for specificity of this LRCH4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRCH4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LRCH4 (Leucine-Rich Repeats and Calponin Homology (CH) Domain Containing 4 (LRCH4))
- Alternative Name
- LRCH4 (LRCH4 Products)
- Synonyms
- LRN antibody, LRRN1 antibody, LRRN4 antibody, PP14183 antibody, 2810008P14Rik antibody, 2900069C24Rik antibody, AI558103 antibody, SAP25 antibody, mFLJ00248 antibody, si:dkeyp-73c8.2 antibody, leucine rich repeats and calponin homology domain containing 4 antibody, leucine-rich repeats and calponin homology (CH) domain containing 4 antibody, LRCH4 antibody, Lrch4 antibody, lrch4 antibody
- Background
- LRCH4 is a protein that contains leucine-rich repeats (LRR) at its amino terminus and that is known to be involved in ligand binding. The carboxyl terminus may act as a membrane anchor. Identified structural elements suggest that this protein resembles a receptor.
- Molecular Weight
- 73 kDa (MW of target protein)
-