CLN8 antibody

Catalog No. ABIN635687

Product Details anti-CLN8 Antibody

Target: CLN8 (Ceroid-Lipofuscinosis, Neuronal 8 (Epilepsy, Progressive with Mental Retardation) (CLN8))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CLN8 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CLN8 antibody was raised using a synthetic peptide corresponding to a region with amino acids MNPASDGGTSESIFDLDYASWGIRSTLMVAGFVFYLGVFVVCHQLSSSLN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CLN8 Blocking Peptide, catalog no. 33R-6257, is also available for use as a blocking control in assays to test for specificity of this CLN8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLN8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CLN8

Target: CLN8 (Ceroid-Lipofuscinosis, Neuronal 8 (Epilepsy, Progressive with Mental Retardation) (CLN8))

Alternative Name: CLN8 (CLN8 Products)

Synonyms: mnd antibody, C8orf61 antibody, EPMR antibody, CLN8, transmembrane ER and ERGIC protein antibody, ceroid-lipofuscinosis, neuronal 8 antibody, CLN8 antibody, Cln8 antibody

Background: CLN8 is a transmembrane protein belonging to a family of proteins containing TLC domains, which are postulated to function in lipid synthesis, transport, or sensing. The protein localizes to the endoplasmic reticulum (ER), and may recycle between the ER and ER-Golgi intermediate compartment.

Molecular Weight: 33 kDa (MW of target protein)

Pathways: Regulation of Cell Size, Dicarboxylic Acid Transport