PIGF antibody (N-Term)

Catalog No. ABIN635684

Product Details anti-PIGF Antibody

Target: PIGF (Phosphatidylinositol Glycan F (PIGF))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PIGF antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PIGF antibody was raised against the N terminal of PIGF

Purification: Affinity purified

Immunogen: PIGF antibody was raised using the N terminal of PIGF corresponding to a region with amino acids MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PIGF Blocking Peptide, catalog no. 33R-6128, is also available for use as a blocking control in assays to test for specificity of this PIGF antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PIGF

Target: PIGF (Phosphatidylinositol Glycan F (PIGF))

Alternative Name: PIGF (PIGF Products)

Synonyms: pigf antibody, zgc:77184 antibody, phosphatidylinositol glycan anchor biosynthesis class F antibody, phosphatidylinositol glycan anchor biosynthesis, class F antibody, phosphatidylinositol glycan anchor biosynthesis class F S homeolog antibody, PIGF antibody, Pigf antibody, pigf.S antibody, pigf antibody

Background: PIGF is a protein involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor, a glycolipid containing three mannose molecules in its core backbone, is found on many blood cells where it serves to anchor proteins to the cell surface. PIGF and another GPI synthesis protein, PIGO, function in the transfer of ethanolaminephosphate to the third mannose in GPI.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: Inositol Metabolic Process