TMEM63B antibody (Middle Region)

Catalog No. ABIN635674

Product Details anti-TMEM63B Antibody

Target: TMEM63B (Transmembrane Protein 63B (TMEM63B))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM63B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM63 B antibody was raised against the middle region of TMEM63

Purification: Affinity purified

Immunogen: TMEM63 B antibody was raised using the middle region of TMEM63 corresponding to a region with amino acids VRGCEQVEAIEYYTKLEQKLKEDYKREKEKVNEKPLGMAFVTFHNETITA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM63B Blocking Peptide, catalog no. 33R-9772, is also available for use as a blocking control in assays to test for specificity of this TMEM63B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM60 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM63B

Target: TMEM63B (Transmembrane Protein 63B (TMEM63B))

Alternative Name: TMEM63B (TMEM63B Products)

Synonyms: C6orf110 antibody, RP3-421H19.2 antibody, BC026370 antibody, RGD1305862 antibody, Tmem63b-ps1 antibody, transmembrane protein 63B antibody, transmembrane protein 63b antibody, TMEM63B antibody, Tmem63b antibody

Background: TMEM63B belongs to the SPO75/TMEM63 family. It is a multi-pass membrane protein. The function of TMEM63B remains unknown.

Molecular Weight: 95 kDa (MW of target protein)