P2RY12 antibody (N-Term)
-
- Target See all P2RY12 Antibodies
- P2RY12 (Purinergic Receptor P2Y, G-Protein Coupled, 12 (P2RY12))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This P2RY12 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- P2 RY12 antibody was raised against the N terminal of P2 Y12
- Purification
- Affinity purified
- Immunogen
- P2 RY12 antibody was raised using the N terminal of P2 Y12 corresponding to a region with amino acids VAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG
- Top Product
- Discover our top product P2RY12 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
P2RY12 Blocking Peptide, catalog no. 33R-9419, is also available for use as a blocking control in assays to test for specificity of this P2RY12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 Y12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- P2RY12 (Purinergic Receptor P2Y, G-Protein Coupled, 12 (P2RY12))
- Alternative Name
- P2RY12 (P2RY12 Products)
- Background
- P2RY12 belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is involved in platelets aggregation, and is a potential target for the treatment of thromboembolisms and other clotting disorders.
- Molecular Weight
- 39 kDa (MW of target protein)
-