P2RY12 antibody (N-Term)

Catalog No. ABIN635667

Product Details anti-P2RY12 Antibody

Target: P2RY12 (Purinergic Receptor P2Y, G-Protein Coupled, 12 (P2RY12))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This P2RY12 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: P2 RY12 antibody was raised against the N terminal of P2 Y12

Purification: Affinity purified

Immunogen: P2 RY12 antibody was raised using the N terminal of P2 Y12 corresponding to a region with amino acids VAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

P2RY12 Blocking Peptide, catalog no. 33R-9419, is also available for use as a blocking control in assays to test for specificity of this P2RY12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 Y12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for P2RY12

Target: P2RY12 (Purinergic Receptor P2Y, G-Protein Coupled, 12 (P2RY12))

Alternative Name: P2RY12 (P2RY12 Products)

Synonyms: 2900079B22Rik antibody, 4921504D23Rik antibody, P2Y12 antibody, ADPG-R antibody, BDPLT8 antibody, HORK3 antibody, P2T(AC) antibody, P2Y(12)R antibody, P2Y(AC) antibody, P2Y(ADP) antibody, P2Y(cyc) antibody, SP1999 antibody, P2y12 antibody, purinergic receptor P2Y, G-protein coupled 12 antibody, purinergic receptor P2Y12 antibody, P2ry12 antibody, P2RY12 antibody

Background: P2RY12 belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is involved in platelets aggregation, and is a potential target for the treatment of thromboembolisms and other clotting disorders.

Molecular Weight: 39 kDa (MW of target protein)