HSD3B1 antibody (N-Term)

Catalog No. ABIN635665

Product Details anti-HSD3B1 Antibody

Target: HSD3B1 (Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 1 (HSD3B1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSD3B1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HSD3 B1 antibody was raised against the N terminal of HSD3 1

Purification: Affinity purified

Immunogen: HSD3 B1 antibody was raised using the N terminal of HSD3 1 corresponding to a region with amino acids TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HSD3B1 Blocking Peptide, catalog no. 33R-9099, is also available for use as a blocking control in assays to test for specificity of this HSD3B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HSD3B1

Target: HSD3B1 (Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 1 (HSD3B1))

Alternative Name: HSD3B1 (HSD3B1 Products)

Synonyms: 3BETAHSD antibody, HSD3B antibody, HSDB3 antibody, HSDB3A antibody, I antibody, SDR11E1 antibody, HSD3B1 antibody, MGC131206 antibody, D3Ertd383e antibody, 3B-HSD antibody, 3BHSD antibody, si:rp71-68n21.10 antibody, hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1 antibody, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 antibody, hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1 L homeolog antibody, HSD3B1 antibody, LOC469446 antibody, LOC713091 antibody, hsd3b1.L antibody, LOC100451655 antibody, Hsd3b1 antibody, hsd3b1 antibody

Background: 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis, C21-Steroid Hormone Metabolic Process, Carbohydrate Homeostasis