DPY19L2 antibody

Catalog No. ABIN635657

Product Details anti-DPY19L2 Antibody

Target: DPY19L2 (Dpy-19-Like 2 (DPY19L2))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DPY19L2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DPY19 L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIGEFNNLPQEELLQWIKYSTTSDAVFAGAMPTMASIKLSTLHPIVNHPH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DPY19L2 Blocking Peptide, catalog no. 33R-3998, is also available for use as a blocking control in assays to test for specificity of this DPY19L2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPY10 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DPY19L2

Target: DPY19L2 (Dpy-19-Like 2 (DPY19L2))

Alternative Name: DPY19L2 (DPY19L2 Products)

Synonyms: SPATA34 antibody, SPGF9 antibody, Dyp19l2 antibody, RGD1564311 antibody, 4932443J21Rik antibody, Gm18376 antibody, DPY19L2 antibody, dpy-19 like 2 antibody, probable C-mannosyltransferase DPY19L2 antibody, dpy-19-like 2 (C. elegans) antibody, DPY19L2 antibody, LOC100460030 antibody, Dpy19l2 antibody

Background: The function of DPY19L2 has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 87 kDa (MW of target protein)