FLJ90709 (Middle Region) antibody
-
- Target
- FLJ90709
- Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FLJ90709 antibody was raised against the middle region of Flj90709
- Purification
- Affinity purified
- Immunogen
- FLJ90709 antibody was raised using the middle region of Flj90709 corresponding to a region with amino acids VLMSNFLFNTGKFIFNFIHHINDTDTILSTNNSNPVICPSAGSGGHPDNS
-
anti-FLJ90709 (Middle Region) antibody
Reactivity: Human, Dog, Guinea Pig, Horse, Mouse, Rabbit, Rat WB Host: Rabbit Polyclonal unconjugated
anti-FLJ90709 antibodyReactivity: Human WB, ELISA Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FLJ90709 Blocking Peptide, catalog no. 33R-9677, is also available for use as a blocking control in assays to test for specificity of this FLJ90709 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ90709 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FLJ90709
- Background
- The function of FLJ90709 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 64 kDa (MW of target protein)
-
