TMEM161B antibody (N-Term)

Catalog No. ABIN635653

Product Details anti-TMEM161B Antibody

Target: TMEM161B (Transmembrane Protein 161B (TMEM161B))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM161B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM161 B antibody was raised against the N terminal of TMEM161

Purification: Affinity purified

Immunogen: TMEM161 B antibody was raised using the N terminal of TMEM161 corresponding to a region with amino acids GSLRWYQHPTEEELRILAGKQQKGKTKKDRKYNGHIESKPLTIPKDIDLH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM161B Blocking Peptide, catalog no. 33R-3573, is also available for use as a blocking control in assays to test for specificity of this TMEM161B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM160 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM161B

Target: TMEM161B (Transmembrane Protein 161B (TMEM161B))

Alternative Name: TMEM161B (TMEM161B Products)

Synonyms: FLB3342 antibody, PRO1313 antibody, 2810446P07Rik antibody, AI843389 antibody, RGD1309660 antibody, id:ibd2207 antibody, wu:fc31d04 antibody, zgc:63626 antibody, transmembrane protein 161B antibody, TMEM161B antibody, Tmem161b antibody, tmem161b antibody

Background: The function of TMEM161 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 55 kDa (MW of target protein)