STOML3 antibody
-
- Target See all STOML3 products
- STOML3 (Stomatin (EPB72)-Like 3 (STOML3))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This STOML3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- STOML3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFLLVIITFPISIWMCLKIIKEYERAVVFRLGRIQADKAKGPGLILVLPC
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
STOML3 Blocking Peptide, catalog no. 33R-8431, is also available for use as a blocking control in assays to test for specificity of this STOML3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STOML3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- STOML3 (Stomatin (EPB72)-Like 3 (STOML3))
- Alternative Name
- STOML3 (STOML3 Products)
- Synonyms
- Epb7.2l antibody, SLP3 antibody, sro antibody, SRO antibody, zgc:110200 antibody, stoml3 antibody, zgc:165564 antibody, stomatin (Epb7.2)-like 3 antibody, stomatin like 3 antibody, stomatin (EPB72)-like 3b antibody, stomatin like 3 L homeolog antibody, stomatin (EPB72)-like 3a antibody, Stoml3 antibody, STOML3 antibody, stoml3b antibody, stoml3.L antibody, stoml3a antibody
- Background
- The function of STOML3 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 32 kDa (MW of target protein)
-