Pannexin 3 antibody (Middle Region)

Catalog No. ABIN635645

Product Details anti-Pannexin 3 Antibody

Target: Pannexin 3 (PANX3)

Binding Specificity: Middle Region

Reactivity: Mammalian

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Pannexin 3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Pannexin 3 antibody was raised against the middle region of PANX3

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Purification: Affinity purified

Immunogen: Pannexin 3 antibody was raised using the middle region of PANX3 corresponding to a region with amino acids IISELDKSYNRSIRLVQHMLKIRQKSSDPYVFWNELEKARKERYFEFPLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Pannexin 3 Blocking Peptide, catalog no. 33R-4008, is also available for use as a blocking control in assays to test for specificity of this Pannexin 3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PANX3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Pannexin 3

Target: Pannexin 3 (PANX3)

Alternative Name: Pannexin 3 (PANX3 Products)

Synonyms: PX3 antibody, 3230401P04 antibody, 4833413G11Rik antibody, pannexin 3 antibody, PANX3 antibody, LOC100533355 antibody, Panx3 antibody

Background: The protein encoded by this gene belongs to the innexin family. Innexin family members are known to be the structural components of gap junctions.

Molecular Weight: 45 kDa (MW of target protein)