C5ORF4 antibody (N-Term)
-
- Target See all C5ORF4 (FAXDC2) products
- C5ORF4 (FAXDC2) (Fatty Acid Hydroxylase Domain Containing 2 (FAXDC2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C5ORF4 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- C5 ORF4 antibody was raised against the N terminal Of C5 rf4
- Purification
- Affinity purified
- Immunogen
- C5 ORF4 antibody was raised using the N terminal Of C5 rf4 corresponding to a region with amino acids MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQ
-
-
- Application Notes
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C5ORF4 Blocking Peptide, catalog no. 33R-6138, is also available for use as a blocking control in assays to test for specificity of this C5ORF4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C5ORF4 (FAXDC2) (Fatty Acid Hydroxylase Domain Containing 2 (FAXDC2))
- Alternative Name
- C5ORF4 (FAXDC2 Products)
- Background
- C5ORF4 is involved in the fatty acid biosynthetic process.
- Molecular Weight
- 21 kDa (MW of target protein)
-