SERPINB13 antibody

Catalog No. ABIN635641

Product Details anti-SERPINB13 Antibody

Target: SERPINB13 (serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 13 (SERPINB13))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SERPINB13 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SERPINB13 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLFGEKTYLFLQKYLDYVEKYYHASLEPVDFVNAADESRKKINSWVESKT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SERPINB13 Blocking Peptide, catalog no. 33R-8019, is also available for use as a blocking control in assays to test for specificity of this SERPINB13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINB13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SERPINB13

Target: SERPINB13 (serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 13 (SERPINB13))

Alternative Name: SERPINB13 (SERPINB13 Products)

Synonyms: HSHUR7SEQ antibody, HUR7 antibody, PI13 antibody, headpin antibody, 5430417G24 antibody, HURPIN antibody, SERPINB13 antibody, SERPINB5 antibody, serpin family B member 13 antibody, serine (or cysteine) peptidase inhibitor, clade B (ovalbumin), member 13 antibody, serpin family B member 12 antibody, SERPINB13 antibody, Serpinb13 antibody, SERPINB12 antibody

Background: SERPINB13 may play a role in the proliferation or differentiation of keratinocytes.

Molecular Weight: 44 kDa (MW of target protein)