SAMD8 antibody (Middle Region)

Catalog No. ABIN635629

Product Details anti-SAMD8 Antibody

Target: SAMD8 (Sterile alpha Motif Domain Containing 8 (SAMD8))

Binding Specificity: Middle Region

Reactivity: Mouse, Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SAMD8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SAMD8 antibody was raised against the middle region of SAMD8

Purification: Affinity purified

Immunogen: SAMD8 antibody was raised using the middle region of SAMD8 corresponding to a region with amino acids MQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SAMD8 Blocking Peptide, catalog no. 33R-6349, is also available for use as a blocking control in assays to test for specificity of this SAMD8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAMD8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SAMD8

Target: SAMD8 (Sterile alpha Motif Domain Containing 8 (SAMD8))

Alternative Name: SAMD8 (SAMD8 Products)

Synonyms: CG32380 antibody, CG8572 antibody, CG8576 antibody, Css3beta antibody, Dmel\\CG32380 antibody, dSMSr antibody, dmSMSr antibody, SMSr antibody, 1110053F04Rik antibody, 1700010P07Rik antibody, CG32380 gene product from transcript CG32380-RA antibody, sterile alpha motif domain containing 8 antibody, SMSr antibody, SAMD8 antibody, samd8 antibody, Samd8 antibody

Background: SAMD8 is a multi-pass membrane protein. It belongs to the sphingomyelin synthase family and contains 1 SAM (sterile alpha motif) domain. The function of the SAMD8 protein remains unknown.

Molecular Weight: 36 kDa (MW of target protein)