Klotho beta antibody (Middle Region)

Catalog No. ABIN635626

Product Details anti-Klotho beta Antibody

Target: Klotho beta (KLB)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Klotho beta antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Klotho Beta antibody was raised against the middle region of KLB

Purification: Affinity purified

Immunogen: Klotho Beta antibody was raised using the middle region of KLB corresponding to a region with amino acids DAYTIRRGLFYVDFNSKQKERKPKSSAHYYKQIIRENGFSLKESTPDVQG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Klotho Beta Blocking Peptide, catalog no. 33R-1868, is also available for use as a blocking control in assays to test for specificity of this Klotho Beta antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Klotho beta

Target: Klotho beta (KLB)

Alternative Name: Klotho beta (KLB Products)

Synonyms: KLB antibody, BKL antibody, AV071179 antibody, betaKlotho antibody, Klb-ps1 antibody, RGD1308227 antibody, klotho beta antibody, KLB antibody, Klb antibody

Background: KLB is a single-pass type III membrane protein. It contributes to the transcriptional repression of cholesterol 7-alpha-hydroxylase (CYP7A1), the rate-limiting enzyme in bile acid synthesis. KLB is probably inactive as a glycosidase. It increases the ability of FGFR1 and FGFR4 to bind FGF21.

Molecular Weight: 120 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Growth Factor Binding