YIPF6 antibody (C-Term)
-
- Target See all YIPF6 products
- YIPF6 (Yip1 Domain Family, Member 6 (YIPF6))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This YIPF6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- YIPF6 antibody was raised against the C terminal of YIPF6
- Purification
- Affinity purified
- Immunogen
- YIPF6 antibody was raised using the C terminal of YIPF6 corresponding to a region with amino acids MVRLFVVIVMFAWSIVASTALLADSQPPNRRALAVYPVFLFYFVISWMIL
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
YIPF6 Blocking Peptide, catalog no. 33R-6602, is also available for use as a blocking control in assays to test for specificity of this YIPF6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YIPF6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- YIPF6 (Yip1 Domain Family, Member 6 (YIPF6))
- Alternative Name
- YIPF6 (YIPF6 Products)
- Background
- YIPF6 is a multi-pass membrane proteinPotential. It belongs to the YIP1 family. The exact function of YIPF6 remains unknown.
- Molecular Weight
- 26 kDa (MW of target protein)
-