YIPF6 antibody (C-Term)

Catalog No. ABIN635621

Product Details anti-YIPF6 Antibody

Target: YIPF6 (Yip1 Domain Family, Member 6 (YIPF6))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This YIPF6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: YIPF6 antibody was raised against the C terminal of YIPF6

Purification: Affinity purified

Immunogen: YIPF6 antibody was raised using the C terminal of YIPF6 corresponding to a region with amino acids MVRLFVVIVMFAWSIVASTALLADSQPPNRRALAVYPVFLFYFVISWMIL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

YIPF6 Blocking Peptide, catalog no. 33R-6602, is also available for use as a blocking control in assays to test for specificity of this YIPF6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YIPF6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for YIPF6

Target: YIPF6 (Yip1 Domain Family, Member 6 (YIPF6))

Alternative Name: YIPF6 (YIPF6 Products)

Synonyms: DDBDRAFT_0204973 antibody, DDBDRAFT_0233687 antibody, DDB_0204973 antibody, DDB_0233687 antibody, zgc:86904 antibody, FinGER6 antibody, A430107J06Rik antibody, Yip1 domain family member 6 antibody, Yipf6 protein antibody, protein YIPF6 antibody, Yip1 domain-containing protein antibody, YIPF6-like protein antibody, YIPF6 antibody, protein YIPF6-like antibody, Yip1 domain family, member 6 antibody, Yip1 domain family member 6 L homeolog antibody, YIPF6 antibody, yipf6 antibody, Yipf6 antibody, EDI_154100 antibody, PITG_00974 antibody, VDBG_00769 antibody, LOC100366793 antibody, yipf6.L antibody

Background: YIPF6 is a multi-pass membrane proteinPotential. It belongs to the YIP1 family. The exact function of YIPF6 remains unknown.

Molecular Weight: 26 kDa (MW of target protein)