CLMN antibody

Catalog No. ABIN635615

Product Details anti-CLMN Antibody

Target: CLMN (Calmin (CLMN))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CLMN antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Calmin antibody was raised using a synthetic peptide corresponding to a region with amino acids SPSSSLSPGSGGTDSDSSFPPTPTAERSVAISVKDQRKAIKALLAWVQRK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Calmin Blocking Peptide, catalog no. 33R-8697, is also available for use as a blocking control in assays to test for specificity of this Calmin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLMN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CLMN

Target: CLMN (Calmin (CLMN))

Alternative Name: Calmin (CLMN Products)

Synonyms: 9330188N17Rik antibody, AI428889 antibody, AI788815 antibody, mKIAA1188 antibody, uncharacterized protein PFB0145c antibody, calmin antibody, LOC5569762 antibody, CpipJ_CPIJ015331 antibody, Clmn antibody, CLMN antibody

Background: CLMN is a single-pass type IV membrane protein. It contains 1 actin-binding domain and 2 CH (calponin-homology) domains. The exact function of CLMN remains unknown.

Molecular Weight: 110 kDa (MW of target protein)