SLC26A4 antibody (Middle Region)

Catalog No. ABIN635614

Product Details anti-SLC26A4 Antibody

Target: SLC26A4 (Solute Carrier Family 26, Member 4 (SLC26A4))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC26A4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC26 A4 antibody was raised against the middle region of SLC26 4

Purification: Affinity purified

Immunogen: SLC26 A4 antibody was raised using the middle region of SLC26 4 corresponding to a region with amino acids ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC26A4 Blocking Peptide, catalog no. 33R-2563, is also available for use as a blocking control in assays to test for specificity of this SLC26A4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC26A4

Target: SLC26A4 (Solute Carrier Family 26, Member 4 (SLC26A4))

Alternative Name: SLC26A4 (SLC26A4 Products)

Synonyms: Pds antibody, DFNB4 antibody, EVA antibody, PDS antibody, TDH2B antibody, pendrin antibody, solute carrier family 26 member 4 antibody, solute carrier family 26, member 4 antibody, SLC26A4 antibody, Slc26a4 antibody

Background: Mutations in this gene are associated with Pendred syndrome, the most common form of syndromic deafness, an autosomal-recessive disease. It is highly homologous to the SLC26A3 gene.

Molecular Weight: 86 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis, Sensory Perception of Sound