SLC38A3 antibody (N-Term)

Catalog No. ABIN635610

Product Details anti-SLC38A3 Antibody

Target: SLC38A3 (Solute Carrier Family 38 Member 3 (SLC38A3))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC38A3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC38 A3 antibody was raised against the N terminal of SLC38 3

Purification: Affinity purified

Immunogen: SLC38 A3 antibody was raised using the N terminal of SLC38 3 corresponding to a region with amino acids GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC38A3 Blocking Peptide, catalog no. 33R-3456, is also available for use as a blocking control in assays to test for specificity of this SLC38A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC38A3

Target: SLC38A3 (Solute Carrier Family 38 Member 3 (SLC38A3))

Alternative Name: SLC38A3 (SLC38A3 Products)

Synonyms: slc38a3 antibody, wu:fc31c02 antibody, wu:fc48a10 antibody, zgc:92015 antibody, MGC69392 antibody, G17 antibody, NAT1 antibody, SN1 antibody, 0610012J02Rik antibody, D9Ucla2 antibody, Nat1 antibody, Slc38-3 antibody, Sn1 antibody, Snat3 antibody, mNAT antibody, solute carrier family 38, member 5b antibody, solute carrier family 38 member 3 antibody, solute carrier family 38, member 3 antibody, slc38a5b antibody, slc38a3 antibody, SLC38A3 antibody, Slc38a3 antibody

Background: As a sodium-dependent amino acid/proton antiporter, SLC38A3 mediates electrogenic cotransport of glutamine and sodium ions in exchange for protons. It also recognises histidine, asparagine and alanine. It may mediate amino acid transport in either direction under physiological conditions and play a role in nitrogen metabolism and synaptic transmission.

Molecular Weight: 56 kDa (MW of target protein)