TMCC2 antibody (N-Term)

Catalog No. ABIN635608

Product Details anti-TMCC2 Antibody

Target: TMCC2 (Transmembrane and Coiled-Coil Domain Family 2 (TMCC2))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMCC2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMCC2 antibody was raised against the N terminal of TMCC2

Purification: Affinity purified

Immunogen: TMCC2 antibody was raised using the N terminal of TMCC2 corresponding to a region with amino acids GETTGANSAGGPTSDAGAAAAPNPGPRSKPPDLKKIQQLSEGSMFGHGLK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMCC2 Blocking Peptide, catalog no. 33R-3253, is also available for use as a blocking control in assays to test for specificity of this TMCC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMCC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMCC2

Target: TMCC2 (Transmembrane and Coiled-Coil Domain Family 2 (TMCC2))

Alternative Name: TMCC2 (TMCC2 Products)

Synonyms: 1110063G11Rik antibody, RGD1311960 antibody, HUCEP11 antibody, zgc:198155 antibody, zgc:198157 antibody, transmembrane and coiled-coil domains 2 antibody, transmembrane and coiled-coil domain family 2 antibody, Tmcc2 antibody, TMCC2 antibody, TMCO2 antibody, tmcc2 antibody

Background: TMCC2 is a multi-pass membrane protein. It belongs to the TEX28 family. The function of TMCC2 remains unknown.

Molecular Weight: 77 kDa (MW of target protein)