C1orf159 antibody (C-Term)

Catalog No. ABIN635604

Product Details anti-C1orf159 Antibody

Target: C1orf159 (Chromosome 1 Open Reading Frame 159 (C1orf159))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C1orf159 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C1 ORF159 antibody was raised against the C terminal Of C1 rf159

Purification: Affinity purified

Immunogen: C1 ORF159 antibody was raised using the C terminal Of C1 rf159 corresponding to a region with amino acids PLPGSPGDPPTRQGQGRIWLVPPALDLSWIWPAPPARPPLIPVTSMLFPV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C1ORF159 Blocking Peptide, catalog no. 33R-7201, is also available for use as a blocking control in assays to test for specificity of this C1ORF159 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF159 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C1orf159

Target: C1orf159 (Chromosome 1 Open Reading Frame 159 (C1orf159))

Alternative Name: C1ORF159 (C1orf159 Products)

Synonyms: DKFZp459M0116 antibody, chromosome 21 C1orf159 homolog antibody, chromosome 1 open reading frame 159 antibody, chromosome 1 open reading frame, human C1orf159 antibody, C21H1orf159 antibody, c1orf159 antibody, C1H1orf159 antibody, C1orf159 antibody

Background: The function of C1orf159 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 42 kDa (MW of target protein)