Cytochrome b antibody (N-Term)
-
- Target See all Cytochrome b (MT-CYB) Antibodies
- Cytochrome b (MT-CYB) (Mitochondrially Encoded Cytochrome B (MT-CYB))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Cytochrome b antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CYTB antibody was raised against the N terminal of CYTB
- Purification
- Affinity purified
- Immunogen
- CYTB antibody was raised using the N terminal of CYTB corresponding to a region with amino acids TPMRKINPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFL
- Top Product
- Discover our top product MT-CYB Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CYTB Blocking Peptide, catalog no. 33R-9225, is also available for use as a blocking control in assays to test for specificity of this CYTB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYTB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Cytochrome b (MT-CYB) (Mitochondrially Encoded Cytochrome B (MT-CYB))
- Alternative Name
- CYTB (MT-CYB Products)
- Background
- CYTB belongs to the cytochrome b family. It is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.
- Molecular Weight
- 42 kDa (MW of target protein)
- Pathways
- Proton Transport
-