JAM3 antibody (N-Term)

Catalog No. ABIN635598

Product Details anti-JAM3 Antibody

Target: JAM3 (Junctional Adhesion Molecule 3 (JAM3))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This JAM3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: JAM3 antibody was raised against the N terminal of JAM3

Purification: Affinity purified

Immunogen: JAM3 antibody was raised using the N terminal of JAM3 corresponding to a region with amino acids SSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

JAM3 Blocking Peptide, catalog no. 33R-8834, is also available for use as a blocking control in assays to test for specificity of this JAM3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JAM3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for JAM3

Target: JAM3 (Junctional Adhesion Molecule 3 (JAM3))

Alternative Name: JAM3 (JAM3 Products)

Synonyms: JAM3 antibody, jam3 antibody, sr:nyz155 antibody, wu:fb30h11 antibody, wu:fc08c06 antibody, wu:fc13e04 antibody, wu:fc25g11 antibody, jamc.2 antibody, 1110002N23Rik antibody, JAM-3 antibody, JAM-C antibody, Jcam3 antibody, JAM-2 antibody, JAMC antibody, junctional adhesion molecule 3 antibody, junctional adhesion molecule 3b antibody, junctional adhesion molecule 3a antibody, junction adhesion molecule 3 antibody, JAM3 antibody, jam3b antibody, jam3a antibody, Jam3 antibody

Background: Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. JAM3, one member of the immunoglobulin superfamily, is localized in the tight junctions between high endothelial cells. Unlike other proteins in this family, this protein is unable to adhere to leukocyte cell lines and only forms weak homotypic interactions. JAM3 is a member of the junctional adhesion molecule protein family and acts as a receptor for another member of this family.

Molecular Weight: 28 kDa (MW of target protein)