BTNL9 antibody (N-Term)

Catalog No. ABIN635592

Product Details anti-BTNL9 Antibody

Target: BTNL9 (Butyrophilin-Like 9 (BTNL9))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BTNL9 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BTNL9 antibody was raised against the N terminal of BTNL9

Purification: Affinity purified

Immunogen: BTNL9 antibody was raised using the N terminal of BTNL9 corresponding to a region with amino acids EIRWFRSQTFNVVHLYQEQQELPGRQMPAFRNRTKLVKDDIAYGSVVLQL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BTNL9 Blocking Peptide, catalog no. 33R-2485, is also available for use as a blocking control in assays to test for specificity of this BTNL9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTNL9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BTNL9

Target: BTNL9 (Butyrophilin-Like 9 (BTNL9))

Alternative Name: BTNL9 (BTNL9 Products)

Synonyms: BTN3 antibody, VDLS1900 antibody, B430208I01 antibody, Btn3 antibody, D330012D11Rik antibody, MGC157148 antibody, butyrophilin like 9 antibody, butyrophilin-like 9 antibody, butyrophilin-like protein 9 antibody, BTNL9 antibody, Btnl9 antibody, LOC100396974 antibody

Background: The specific function of BTNL9 is not yet known.

Molecular Weight: 60 kDa (MW of target protein)