TECR antibody (Middle Region)

Catalog No. ABIN635589

Product Details anti-TECR Antibody

Target: TECR (Trans-2,3-Enoyl-CoA Reductase (TECR))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TECR antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GPSN2 antibody was raised against the middle region of GPSN2

Purification: Affinity purified

Immunogen: GPSN2 antibody was raised using the middle region of GPSN2 corresponding to a region with amino acids PFIYGHKYDFTSSRHTVVHLACICHSFHYIKRLLETLFVHRFSHGTMPLR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GPSN2 Blocking Peptide, catalog no. 33R-7077, is also available for use as a blocking control in assays to test for specificity of this GPSN2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPSN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TECR

Target: TECR (Trans-2,3-Enoyl-CoA Reductase (TECR))

Alternative Name: GPSN2 (TECR Products)

Synonyms: GPSN2 antibody, MRT14 antibody, SC2 antibody, TER antibody, 2410016D23Rik antibody, A230102P12Rik antibody, AI173355 antibody, D17Ertd178e antibody, Gpsn2 antibody, cb250 antibody, gpsn2 antibody, mg:db03b10 antibody, sb:cb250 antibody, wu:fj63b12 antibody, glycoprotein, synaptic 2 antibody, trans-2,3-enoyl-CoA reductase antibody, trans-2,3-enoyl-CoA reductase b antibody, gpsn2 antibody, TECR antibody, Tecr antibody, tecrb antibody

Background: Microsomal long and very long chain fatty acid elongation uses malonyl-CoA as the 2-carbon donor and consists of 4 sequential reactions. GPSN2 catalyzes the final step, reducing trans-2,3-enoyl-CoA to saturated acyl-CoA.

Molecular Weight: 36 kDa (MW of target protein)