FAM200A antibody (Middle Region)
-
- Target See all FAM200A (C7orf38) Antibodies
- FAM200A (C7orf38) (Chromosome 7 Open Reading Frame 38 (C7orf38))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FAM200A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C7 ORF38 antibody was raised against the middle region of C7 rf38
- Purification
- Affinity purified
- Immunogen
- C7 ORF38 antibody was raised using the middle region of C7 rf38 corresponding to a region with amino acids QTFNYYFPEEKFESLKENIWMKDPFAFQNPESIIELNLEPEEENELLQLS
- Top Product
- Discover our top product C7orf38 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C7ORF38 Blocking Peptide, catalog no. 33R-7749, is also available for use as a blocking control in assays to test for specificity of this C7ORF38 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF38 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM200A (C7orf38) (Chromosome 7 Open Reading Frame 38 (C7orf38))
- Alternative Name
- C7ORF38 (C7orf38 Products)
- Background
- The function of C7ORF38 protein has not been widely studied, and is yet to be fully elucidated. The protein is weakly similar to transposase-like proteins in human and mouse.
- Molecular Weight
- 66 kDa (MW of target protein)
-