PLP1 antibody (Middle Region)

Catalog No. ABIN635575

Product Details anti-PLP1 Antibody

Target: PLP1 (Proteolipid Protein 1 (PLP1))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PLP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PLP1 antibody was raised against the middle region of PLP1

Purification: Affinity purified

Immunogen: PLP1 antibody was raised using the middle region of PLP1 corresponding to a region with amino acids IYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PLP1 Blocking Peptide, catalog no. 33R-4219, is also available for use as a blocking control in assays to test for specificity of this PLP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PLP1

Target: PLP1 (Proteolipid Protein 1 (PLP1))

Alternative Name: PLP1 (PLP1 Products)

Synonyms: GPM6C antibody, HLD1 antibody, MMPL antibody, PLP antibody, PLP/DM20 antibody, PMD antibody, SPG2 antibody, Plp antibody, PLP1 antibody, plp1 antibody, DKFZp459O081 antibody, DKFZp459O113 antibody, DM20 antibody, jimpy antibody, jp antibody, msd antibody, rsh antibody, plp antibody, hld1 antibody, mmpl antibody, plp1a antibody, pmd antibody, spg2 antibody, DMalpha2c antibody, wu:fc27f01 antibody, wu:fj36d03 antibody, wu:fj42d08 antibody, zgc:110499 antibody, PLP-B antibody, plp1-a antibody, plp1-b antibody, plp1b antibody, proteolipid protein 1 antibody, proteolipid protein (myelin) 1 antibody, myelin proteolipid protein antibody, proteolipid protein 1 L homeolog antibody, proteolipid protein 1a antibody, proteolipid protein 1 S homeolog antibody, PLP1 antibody, Plp1 antibody, plp1 antibody, Tsp_11640 antibody, plp antibody, plp1.L antibody, plp1a antibody, plp1.S antibody

Background: PLP1 is a transmembrane proteolipid protein that is the predominant myelin protein present in the central nervous system. It may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axonal survival. Mutations in this gene cause X-linked Pelizaeus-Merzbacher disease and spastic paraplegia type 2.

Molecular Weight: 30 kDa (MW of target protein)